PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN40304.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 560aa    MW: 61550.6 Da    PI: 8.7991
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN40304.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.88.1e-1660106148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT++Ede l +av+ + g++Wk+Ia+ ++  R++ qc +rwqk+l
       KHN40304.1  60 KGGWTAQEDETLRNAVAVFKGKSWKKIAEFFP-DRSEVQCLHRWQKVL 106
                      688*****************************.************986 PP

2Myb_DNA-binding62.67.7e-20112158148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd+++v++v ++G+  W++Ia+ ++ gR +kqc++rw+++l
       KHN40304.1 112 KGPWTQEEDDKIVELVSKYGPTKWSLIAKSLP-GRIGKQCRERWHNHL 158
                      79******************************.*************97 PP

3Myb_DNA-binding51.22.9e-16164207146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WT eE++ l +a++ +G++ W+ Ia+ +  gRt++ +k++w++
       KHN40304.1 164 KDAWTLEEELALMNAHRIHGNK-WAEIAKVLH-GRTDNAIKNHWNS 207
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.72855106IPR017930Myb domain
SuperFamilySSF466891.87E-1457113IPR009057Homeodomain-like
SMARTSM007171.5E-1359108IPR001005SANT/Myb domain
PfamPF002492.6E-1460106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-2162114IPR009057Homeodomain-like
CDDcd001673.02E-1263106No hitNo description
PROSITE profilePS5129433.151107162IPR017930Myb domain
SuperFamilySSF466892.16E-31109205IPR009057Homeodomain-like
SMARTSM007171.9E-18111160IPR001005SANT/Myb domain
PfamPF002496.7E-19112158IPR001005SANT/Myb domain
CDDcd001671.66E-16114158No hitNo description
Gene3DG3DSA:1.10.10.604.3E-28115161IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-22162213IPR009057Homeodomain-like
PROSITE profilePS5129421.338163213IPR017930Myb domain
SMARTSM007177.3E-15163211IPR001005SANT/Myb domain
PfamPF002492.1E-14164207IPR001005SANT/Myb domain
CDDcd001671.58E-11166209No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MAEVVKSEEC CQENKQSTAA SCSSVSEGSG SAIHKSPGRC SPASTSPSHR RTTGPIRRAK  60
GGWTAQEDET LRNAVAVFKG KSWKKIAEFF PDRSEVQCLH RWQKVLNPEL VKGPWTQEED  120
DKIVELVSKY GPTKWSLIAK SLPGRIGKQC RERWHNHLNP DIKKDAWTLE EELALMNAHR  180
IHGNKWAEIA KVLHGRTDNA IKNHWNSSLK KKLDFYLATG RLPPIPKNSP QVPVKDTIRR  240
SASKSMLGCS NKELNAAVET SSETTAISKL DDSGRNQFES SGTVREVGDS SSVPANDSAD  300
SDCVECKPGS SNINPSCSNS EHVSRANFGT TFGPISENSG LNGNSTFEHC TNNGDRSSTR  360
LIGTSSQENP TCGSLCYEPP QLDGSVPIDS LYLNYTCQQN EYCPSPTMSP TGFFTPPRAK  420
GSELCTETPE SILRKAANTF PNTPSILRRR RTGAQTLTSP TKVLKVDNNP HTSNKTERTN  480
DDSGSGHFSG SPASHGYGIG IPNNKAFNAS PPYRLRSKRT AIVKSVEKQL EFAFDKEKND  540
DKRSNVMTED RLHEKKLVVT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C9e-67592135159MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-67592135159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003529095.10.0PREDICTED: myb-like protein A
TrEMBLA0A0B2S7P60.0A0A0B2S7P6_GLYSO; Myb-related protein 3R-1
TrEMBLK7L1G60.0K7L1G6_SOYBN; Uncharacterized protein
STRINGGLYMA07G15820.40.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66163449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09370.21e-148myb domain protein 3r-3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]